PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DS_16243E52C.2
Common NameAGL31, AGL9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 28254.3 Da    PI: 9.6656
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DS_16243E52C.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.61e-30959151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Traes_5DS_16243E52C.2  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
                           79***********************************************95 PP

2K-box96.54.1e-32841759100
                  K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                             e + ++++qqe+akL+ +i++Lq++++hl+G+++++LslkeL+qLe++Lek++ kiR++Knell ++i+++ k+e elq++  +Lr+
  Traes_5DS_16243E52C.2  84 IEVNAQQYYQQEAAKLRHQIQMLQSTNKHLVGDSVGNLSLKELKQLESRLEKGIAKIRARKNELLSSEINYMVKREIELQSDSIDLRT 171
                            5667899********************************************************************************* PP

                  K-box  97 klee 100
                            k++e
  Traes_5DS_16243E52C.2 172 KIAE 175
                            *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.27E-32274IPR002100Transcription factor, MADS-box
CDDcd002653.24E-44274No hitNo description
PRINTSPR004045.6E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2386173IPR002487Transcription factor, K-box
PROSITE profilePS5129713.87889179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRGRIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
SVKATIDRYK KAHACGSTSG VPLIEVNAQQ YYQQEAAKLR HQIQMLQSTN KHLVGDSVGN  120
LSLKELKQLE SRLEKGIAKI RARKNELLSS EINYMVKREI ELQSDSIDLR TKIAEEEQRL  180
QQVTIARPSV APELNPFTAL DMKCFFPANL FEAAVHAHAQ AQAQAQAQAS LQLNLGYQQL  240
APPGAGDVAH QF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-19169169Myocyte-specific enhancer factor 2B
1tqe_R2e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q2e-19169169Myocyte-specific enhancer factor 2B
1tqe_P2e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ5123490.0DQ512349.1 Triticum aestivum MADS-box transcription factor TaAGL31 (AGL31) mRNA, complete cds.
GenBankDQ5123640.0DQ512364.1 Triticum aestivum MADS-box transcription factor TaAGL9 (AGL9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578791.11e-158PREDICTED: uncharacterized protein LOC100836399 isoform X2
SwissprotQ2QW531e-134MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLQ1G1610.0Q1G161_WHEAT; MADS-box transcription factor TaAGL31
STRINGMLOC_57890.11e-162(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.13e-83MIKC_MADS family protein
Publications ? help Back to Top
  1. Zhao T, et al.
    Characterization and expression of 42 MADS-box genes in wheat (Triticum aestivum L.).
    Mol. Genet. Genomics, 2006. 276(4): p. 334-50
    [PMID:16858583]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]